SCOPe 2.07: Domain d6jn3d_: 6jn3 D:

Lineage for d6jn3d_ (6jn3 D:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d6jn3d_: 6jn3 D: [370708]
   Other proteins in same PDB: d6jn3a2, d6jn3c2
   automated match to d3c5aa_
   complexed with acy, bx6, peg

Details for d6jn3d_

PDB Entry: 6jn3, 2.22 Å

PDB Description: serine beta-lactamase kpc-2 in complex with dual mbl/sbl inhibitor ms05

PDB Compounds: (D:) Serine Beta-Lactamase KPC-2

SCOPe Domain Sequences for d6jn3d_:

Sequence; same for both SEQRES and ATOM records:

>d6jn3d_ e.3.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
aepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsqqqagl
ldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggpaglta
fmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrqqfvdw
lkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytrapnkd
dkhseaviaaaarlaleglg

Timeline for d6jn3d_:

• d6jn3d_ is new in SCOPe 2.07-stable
  
• d6jn3d_ appears in the current release, SCOPe 2.08