SCOPe 2.07: Domain d6n8wa1: 6n8w A:1-217

Lineage for d6n8wa1 (6n8w A:1-217)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries)

8. Domain d6n8wa1: 6n8w A:1-217 [370694]
   Other proteins in same PDB: d6n8wa2, d6n8wb2, d6n8wd2
   automated match to d2xjxa_
   complexed with gol

Details for d6n8wa1

PDB Entry: 6n8w, 3.09 Å

PDB Description: structure of unliganded hsp90-beta n-terminal domain

PDB Compounds: (A:) heat shock protein hsp 90-beta

SCOPe Domain Sequences for d6n8wa1:

Sequence; same for both SEQRES and ATOM records:

>d6n8wa1 d.122.1.1 (A:1-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpeevhhgeeevetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiryeslt
dpskldsgkelkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmealqag
adismigqfgvgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepigrgtk
vilhlkedqteyleerrvkevvkkhsqfigypitlyl

Timeline for d6n8wa1:

• d6n8wa1 is new in SCOPe 2.07-stable
  
• d6n8wa1 appears in the current release, SCOPe 2.08