Lineage for d6mnmb1 (6mnm B:1-111)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (706 PDB entries)
  8. 3070582Domain d6mnmb1: 6mnm B:1-111 [370644]
    Other proteins in same PDB: d6mnma2, d6mnmb2, d6mnmc1, d6mnmc2, d6mnmc3
    automated match to d3rugf1

Details for d6mnmb1

PDB Entry: 6mnm (more details), 3.1 Å

PDB Description: 6256 tcr bound to i-ab padi4
PDB Compounds: (B:) 6256 TCR beta chain

SCOPe Domain Sequences for d6mnmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mnmb1 b.1.1.0 (B:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvle

SCOPe Domain Coordinates for d6mnmb1:

Click to download the PDB-style file with coordinates for d6mnmb1.
(The format of our PDB-style files is described here.)

Timeline for d6mnmb1: