Lineage for d6mnma2 (6mnm A:115-202)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (584 PDB entries)
  8. 3070578Domain d6mnma2: 6mnm A:115-202 [370640]
    Other proteins in same PDB: d6mnma1, d6mnmb1, d6mnmc1, d6mnmc2, d6mnmc3
    automated match to d2f54d2

Details for d6mnma2

PDB Entry: 6mnm (more details), 3.1 Å

PDB Description: 6256 tcr bound to i-ab padi4
PDB Compounds: (A:) 6256 TCR alpha chain

SCOPe Domain Sequences for d6mnma2:

Sequence, based on SEQRES records: (download)

>d6mnma2 b.1.1.2 (A:115-202) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d6mnma2 b.1.1.2 (A:115-202) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
wsndfacanafnnsiipedtffp

SCOPe Domain Coordinates for d6mnma2:

Click to download the PDB-style file with coordinates for d6mnma2.
(The format of our PDB-style files is described here.)

Timeline for d6mnma2: