Lineage for d6mj5b1 (6mj5 B:162-350)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584375Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2584376Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2584401Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins)
  6. 2584402Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. 2584412Species Human (Homo sapiens) [TaxId:9606] [69817] (36 PDB entries)
  8. 2584529Domain d6mj5b1: 6mj5 B:162-350 [370628]
    automated match to d1qzqa1
    protein/DNA complex; complexed with edo, jta

Details for d6mj5b1

PDB Entry: 6mj5 (more details), 1.85 Å

PDB Description: crystal structure of tdp1 catalytic domain in complex with compound xz519
PDB Compounds: (B:) tyrosyl-DNA phosphodiesterase 1

SCOPe Domain Sequences for d6mj5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mj5b1 d.136.1.3 (B:162-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens) [TaxId: 9606]}
npfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppefrk
kpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvviht
snlihadwhqktqgiwlsplypriadgthksgespthfkadlisylmaynapslkewidv
ihkhdlset

SCOPe Domain Coordinates for d6mj5b1:

Click to download the PDB-style file with coordinates for d6mj5b1.
(The format of our PDB-style files is described here.)

Timeline for d6mj5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6mj5b2