Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries) |
Domain d6mayb1: 6may B:27-210 [370606] automated match to d1iica1 complexed with cl, edo, so4, ync; mutant |
PDB Entry: 6may (more details), 2.05 Å
SCOPe Domain Sequences for d6mayb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mayb1 d.108.1.0 (B:27-210) automated matches {Plasmodium vivax [TaxId: 5855]} dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv sdar
Timeline for d6mayb1: