SCOPe 2.07: Domain d6m87k1: 6m87 K:1-107

Lineage for d6m87k1 (6m87 K:1-107)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
Domain d6m87k1: 6m87 K:1-107 [370572]
Other proteins in same PDB: d6m87a2, d6m87c2, d6m87e2, d6m87g2, d6m87i2, d6m87k2
automated match to d2fd6l1
complexed with 2m9, so4

Details for d6m87k1

PDB Entry: 6m87 (more details), 2.61 Å

PDB Description: fab 10a6 in complex with mpts

PDB Compounds: (K:) Fab 10A6 light chain

SCOPe Domain Sequences for d6m87k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m87k1 b.1.1.0 (K:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvltqspaimsaspgekvtmtcsasssvsyvhwyqqksgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyychqwrtnpptfgagtkleik

SCOPe Domain Coordinates for d6m87k1:

Click to download the PDB-style file with coordinates for d6m87k1.
(The format of our PDB-style files is described here.)

Timeline for d6m87k1: