SCOPe 2.07: Domain d6k1za1: 6k1z A:5-283

Lineage for d6k1za1 (6k1z A:5-283)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d6k1za1: 6k1z A:5-283 [370535]
   Other proteins in same PDB: d6k1za2
   automated match to d1dg3a2
   complexed with far

Details for d6k1za1

PDB Entry: 6k1z, 2.31 Å

PDB Description: crystal structure of farnesylated hgbp1

PDB Compounds: (A:) Guanylate-binding protein 1

SCOPe Domain Sequences for d6k1za1:

Sequence, based on SEQRES records:

>d6k1za1 c.37.1.8 (A:5-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkg
fslgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllss
tfvynsigtinqqamdqlyyvtelthrirsksspdenenevedsadfvsffpdfvwtlrd
fsldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhr
rklaqleklqdeeldpefvqqvadfcsyifsnsktktls

Sequence, based on observed residues (ATOM records):

>d6k1za1 c.37.1.8 (A:5-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkhtk
giwmwcvphpkkpghilvlldteglgdnqndswifalavllsstfvynsigtinqqamdq
lyyvtelthrirsksspevedsadfvsffpdfvwtlrdfsldlpltpdeyltyslklkkg
tsqkdetfnlprlcirkffpkkkcfvfdrpdpefvqqvadfcsyifsnsktktls

Timeline for d6k1za1:

• d6k1za1 is new in SCOPe 2.07-stable
  
• d6k1za1 appears in the current release, SCOPe 2.08