Lineage for d6k3hp_ (6k3h P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2558476Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2558477Protein automated matches [191087] (19 species)
    not a true protein
  7. 2558538Species Aspergillus flavus [TaxId:332952] [370521] (2 PDB entries)
  8. 2558554Domain d6k3hp_: 6k3h P: [370531]
    automated match to d4fkxa_

Details for d6k3hp_

PDB Entry: 6k3h (more details), 2.18 Å

PDB Description: crystallographic analysis of nucleoside diphosphate kinase (ndk) from aspergillus flavus
PDB Compounds: (P:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d6k3hp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k3hp_ d.58.6.0 (P:) automated matches {Aspergillus flavus [TaxId: 332952]}
deqtfiaikpdgvqrglvgpiisrfenrgfklaalklcspskehleqhyadlsskpffpg
lvsymlsgpivamvwegrevvktgrtilgatnplasapgtirgdfaidvgrnvchgsdsv
enakkeialwfkpeelqkykhsqfdwiyek

SCOPe Domain Coordinates for d6k3hp_:

Click to download the PDB-style file with coordinates for d6k3hp_.
(The format of our PDB-style files is described here.)

Timeline for d6k3hp_: