Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (19 species) not a true protein |
Species Aspergillus flavus [TaxId:332952] [370521] (2 PDB entries) |
Domain d6k3hp_: 6k3h P: [370531] automated match to d4fkxa_ |
PDB Entry: 6k3h (more details), 2.18 Å
SCOPe Domain Sequences for d6k3hp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k3hp_ d.58.6.0 (P:) automated matches {Aspergillus flavus [TaxId: 332952]} deqtfiaikpdgvqrglvgpiisrfenrgfklaalklcspskehleqhyadlsskpffpg lvsymlsgpivamvwegrevvktgrtilgatnplasapgtirgdfaidvgrnvchgsdsv enakkeialwfkpeelqkykhsqfdwiyek
Timeline for d6k3hp_: