SCOPe 2.07: Domain d6k5ef_: 6k5e F:

Lineage for d6k5ef_ (6k5e F:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.26: Biotin biosynthesis protein BioH [82509] (2 proteins)
   automatically mapped to Pfam PF12697
   automatically mapped to Pfam PF00561

6. Protein Biotin biosynthesis protein BioH [82510] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [370511] (1 PDB entry)

8. Domain d6k5ef_: 6k5e F: [370515]
   automated match to d1m33a_

Details for d6k5ef_

PDB Entry: 6k5e, 2.26 Å

PDB Description: crystal structure of bioh from klebsiella pneumonia

PDB Compounds: (F:) Pimeloyl-[acyl-carrier protein] methyl ester esterase

SCOPe Domain Sequences for d6k5ef_:

Sequence, based on SEQRES records:

>d6k5ef_ c.69.1.26 (F:) Biotin biosynthesis protein BioH {Klebsiella pneumoniae [TaxId: 573]}
diwwqtigegdchlvllhgwglnaqvwdcitpqlashftlhlvdlpgygrsggfgamsle
amaqrvleqappqavwlgwslgglvasqvaimrpervqalvtvasspcfaarddwpgikp
evlagfqqqlsddfqrtverflalqtmgtesarqdaralkqavlslpmpsaealngglei
lrtvdlrqalvrlpmpflrlygrldglvprkivpllddlwpesesilfdkaahapfvshp
aafcepllalktrl

Sequence, based on observed residues (ATOM records):

>d6k5ef_ c.69.1.26 (F:) Biotin biosynthesis protein BioH {Klebsiella pneumoniae [TaxId: 573]}
diwwqtigegdchlvllhgwglnaqvwdcitpqlashftlhlvdlpgygrsggfgamsle
amaqrvleqappqavwlgwslgglvasqvaimrpervqalvtvasspcfaarddwpgikp
evlagfqqqlfqtvflalqtmgtesarqdaralkqavlslpmpsaealnggleilrtvdl
rpmpflrlygrldglvpkivplldesilfdkaahapfvshpaafcepllalktrl

Timeline for d6k5ef_:

• d6k5ef_ is new in SCOPe 2.07-stable
  
• d6k5ef_ appears in the current release, SCOPe 2.08