Lineage for d6jk5a_ (6jk5 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608583Species Hypomesus nipponensis [TaxId:182223] [370484] (2 PDB entries)
  8. 2608585Domain d6jk5a_: 6jk5 A: [370499]
    automated match to d2afpa_
    complexed with so4

Details for d6jk5a_

PDB Entry: 6jk5 (more details), 1.25 Å

PDB Description: ca2+-dependent type ii antifreeze protein (ca2+-free form)
PDB Compounds: (A:) Type II antifreeze protein

SCOPe Domain Sequences for d6jk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jk5a_ d.169.1.0 (A:) automated matches {Hypomesus nipponensis [TaxId: 182223]}
cptdwklfdgtcylfnpsvlhwadaqescmkegaslasihsleqytfvkelttaaltpsw
lgggdcqvstrwfwmdgtsmdftdwcyaqpdttltecciqmnvgvgkcwddtpcthlhss
icakt

SCOPe Domain Coordinates for d6jk5a_:

Click to download the PDB-style file with coordinates for d6jk5a_.
(The format of our PDB-style files is described here.)

Timeline for d6jk5a_: