Lineage for d6jo5j_ (6jo5 J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631539Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 2631562Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 2631563Protein automated matches [276198] (4 species)
    not a true protein
  7. 2631566Species Chlamydomonas reinhardtii [TaxId:3055] [370433] (4 PDB entries)
  8. 2631570Domain d6jo5j_: 6jo5 J: [370448]
    Other proteins in same PDB: d6jo51_, d6jo53_, d6jo54_, d6jo57_, d6jo58_, d6jo59_, d6jo5a_, d6jo5b_, d6jo5c_, d6jo5d_, d6jo5e_, d6jo5f_, d6jo5z_
    automated match to d5l8rj_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo5j_

PDB Entry: 6jo5 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6jo5j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo5j_ f.23.18.0 (J:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
mkdfttylstapviatiwftftagllieinryfpdplvf

SCOPe Domain Coordinates for d6jo5j_:

Click to download the PDB-style file with coordinates for d6jo5j_.
(The format of our PDB-style files is described here.)

Timeline for d6jo5j_: