Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) automatically mapped to Pfam PF01701 |
Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
Protein automated matches [276198] (4 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [370433] (4 PDB entries) |
Domain d6jo5j_: 6jo5 J: [370448] Other proteins in same PDB: d6jo51_, d6jo53_, d6jo54_, d6jo57_, d6jo58_, d6jo59_, d6jo5a_, d6jo5b_, d6jo5c_, d6jo5d_, d6jo5e_, d6jo5f_, d6jo5z_ automated match to d5l8rj_ complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4 |
PDB Entry: 6jo5 (more details), 2.9 Å
SCOPe Domain Sequences for d6jo5j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jo5j_ f.23.18.0 (J:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} mkdfttylstapviatiwftftagllieinryfpdplvf
Timeline for d6jo5j_: