SCOP 1.69: Domain d1f2ba_: 1f2b A:

Lineage for d1f2ba_ (1f2b A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (11 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (23 proteins)

6. Protein Cruzain [54020] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [54021] (12 PDB entries)

8. Domain d1f2ba_: 1f2b A: [37042]

Details for d1f2ba_

PDB Entry: 1f2b, 1.8 Å

PDB Description: crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (iii)

SCOP Domain Sequences for d1f2ba_:

Sequence; same for both SEQRES and ATOM records:

>d1f2ba_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

Timeline for d1f2ba_:

• d1f2ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1f2ba_ appears in SCOP 1.67
  
• d1f2ba_ appears in SCOP 1.71
  
• d1f2ba_ appears in the current release, SCOPe 2.08