Lineage for d6jn6a_ (6jn6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603137Species Pseudomonas aeruginosa [TaxId:287] [189349] (72 PDB entries)
  8. 2603203Domain d6jn6a_: 6jn6 A: [370417]
    automated match to d5lsca_
    complexed with by0, fmt, zn

Details for d6jn6a_

PDB Entry: 6jn6 (more details), 1.6 Å

PDB Description: metallo-beta-lactamase vim-2 in complex with dual mbl/sbl inhibitor ms19
PDB Compounds: (A:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d6jn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jn6a_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

SCOPe Domain Coordinates for d6jn6a_:

Click to download the PDB-style file with coordinates for d6jn6a_.
(The format of our PDB-style files is described here.)

Timeline for d6jn6a_: