![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein Cytochrome c oxidase subunit h [47696] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries) |
![]() | Domain d6j8mu_: 6j8m U: [370342] Other proteins in same PDB: d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_ automated match to d1v54h_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 6j8m (more details), 1.9 Å
SCOPe Domain Sequences for d6j8mu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j8mu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d6j8mu_:
![]() Domains from other chains: (mouse over for more information) d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_ |