Lineage for d6im3d_ (6im3 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2422210Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2422211Protein automated matches [191011] (16 species)
    not a true protein
  7. 2422381Species Persephonella marina [TaxId:123214] [370264] (3 PDB entries)
  8. 2422391Domain d6im3d_: 6im3 D: [370280]
    automated match to d4coqb_
    complexed with azm, ca, pg4, zn

Details for d6im3d_

PDB Entry: 6im3 (more details), 2 Å

PDB Description: crystal structure of a highly thermostable carbonic anhydrase from persephonella marina ex-h1
PDB Compounds: (D:) Carbonic anhydrase (Carbonate dehydratase)

SCOPe Domain Sequences for d6im3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6im3d_ b.74.1.0 (D:) automated matches {Persephonella marina [TaxId: 123214]}
gwsyhgehgpehwgdlkdeyimckigknqspvdinrivdaklkpikieyragatkvlnng
htikvsyepgsyivvdgikfelkqfhfhapsehklkgqhypfeahfvhadkhgnlavigv
ffkegrenpilekiwkvmpenageevklahkinaedllpkdrdyyrysgslttppcsegv
rwivmeeememskeqiekfrkimggdtnrpvqplnarmimek

SCOPe Domain Coordinates for d6im3d_:

Click to download the PDB-style file with coordinates for d6im3d_.
(The format of our PDB-style files is described here.)

Timeline for d6im3d_: