Class b: All beta proteins [48724] (178 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Persephonella marina [TaxId:123214] [370264] (3 PDB entries) |
Domain d6im3d_: 6im3 D: [370280] automated match to d4coqb_ complexed with azm, ca, pg4, zn |
PDB Entry: 6im3 (more details), 2 Å
SCOPe Domain Sequences for d6im3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6im3d_ b.74.1.0 (D:) automated matches {Persephonella marina [TaxId: 123214]} gwsyhgehgpehwgdlkdeyimckigknqspvdinrivdaklkpikieyragatkvlnng htikvsyepgsyivvdgikfelkqfhfhapsehklkgqhypfeahfvhadkhgnlavigv ffkegrenpilekiwkvmpenageevklahkinaedllpkdrdyyrysgslttppcsegv rwivmeeememskeqiekfrkimggdtnrpvqplnarmimek
Timeline for d6im3d_: