Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries) |
Domain d6i4ja1: 6i4j A:6-147 [370278] Other proteins in same PDB: d6i4ja2, d6i4jg_ automated match to d2btfa1 complexed with adp, btb, ca, k, mg, scn; mutant |
PDB Entry: 6i4j (more details), 1.5 Å
SCOPe Domain Sequences for d6i4ja1:
Sequence, based on SEQRES records: (download)
>d6i4ja1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]} vqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdayvgdeaqtkrgi ltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimf esfnvpamyvaiqavlslyssg
>d6i4ja1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]} vqalvvdngsgnvkagvagddaprsvfpsivgrpkndayvgdeaqtkrgiltlkypiehg ivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvpamyv aiqavlslyssg
Timeline for d6i4ja1: