Lineage for d6i4dg_ (6i4d G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576229Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2576413Protein automated matches [226883] (2 species)
    not a true protein
  7. 2576420Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries)
  8. 2576423Domain d6i4dg_: 6i4d G: [370273]
    Other proteins in same PDB: d6i4da1, d6i4da2
    automated match to d4cbug_
    complexed with adp, atp, btb, ca, cl, k, mg, scn

Details for d6i4dg_

PDB Entry: 6i4d (more details), 1.24 Å

PDB Description: crystal structure of plasmodium falciparum actin i in the mg-k-atp/adp state
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d6i4dg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i4dg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrqgqlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggvas
gf

SCOPe Domain Coordinates for d6i4dg_:

Click to download the PDB-style file with coordinates for d6i4dg_.
(The format of our PDB-style files is described here.)

Timeline for d6i4dg_: