| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
| Protein automated matches [226883] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries) |
| Domain d6i4dg_: 6i4d G: [370273] Other proteins in same PDB: d6i4da1, d6i4da2 automated match to d4cbug_ complexed with adp, atp, btb, ca, cl, k, mg, scn |
PDB Entry: 6i4d (more details), 1.24 Å
SCOPe Domain Sequences for d6i4dg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i4dg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrqgqlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggvas
gf
Timeline for d6i4dg_: