SCOPe 2.07: Domain d6i79a1: 6i79 A:1-261

Lineage for d6i79a1 (6i79 A:1-261)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Sepiapterin reductase [51767] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries)
   Uniprot P35270 5-261

8. Domain d6i79a1: 6i79 A:1-261 [370254]
   Other proteins in same PDB: d6i79a2, d6i79b2
   automated match to d4hwka_
   complexed with h5e, nap

Details for d6i79a1

PDB Entry: 6i79, 1.63 Å

PDB Description: sepiapterin reductase in complex with compound 4

PDB Compounds: (A:) sepiapterin reductase

SCOPe Domain Sequences for d6i79a1:

Sequence; same for both SEQRES and ATOM records:

>d6i79a1 c.2.1.2 (A:1-261) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
megglgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersg
lrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqv
nnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardml
fqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqk
llsllekdefksgahvdfydk

Timeline for d6i79a1:

• d6i79a1 is new in SCOPe 2.07-stable
  
• d6i79a1 appears in the current release, SCOPe 2.08