Lineage for d6i4lg_ (6i4l G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576229Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2576413Protein automated matches [226883] (2 species)
    not a true protein
  7. 2576420Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries)
  8. 2576429Domain d6i4lg_: 6i4l G: [370212]
    Other proteins in same PDB: d6i4la1, d6i4la2
    automated match to d4cbug_
    complexed with adp, atp, ca, mg, scn; mutant

Details for d6i4lg_

PDB Entry: 6i4l (more details), 1.83 Å

PDB Description: crystal structure of plasmodium falciparum actin i (g115a mutant) in the mg-k-atp/adp state
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d6i4lg_:

Sequence, based on SEQRES records: (download)

>d6i4lg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggvas
gf

Sequence, based on observed residues (ATOM records): (download)

>d6i4lg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqllqydlhywlgn
ecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggvasgf

SCOPe Domain Coordinates for d6i4lg_:

Click to download the PDB-style file with coordinates for d6i4lg_.
(The format of our PDB-style files is described here.)

Timeline for d6i4lg_: