SCOPe 2.07: Domain d6i4ha2: 6i4h A:148-366

Lineage for d6i4ha2 (6i4h A:148-366)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [336601] (11 PDB entries)

8. Domain d6i4ha2: 6i4h A:148-366 [370183]
   Other proteins in same PDB: d6i4ha1, d6i4hg_
   automated match to d3ub5a2
   complexed with atp, ca, cl, peg; mutant

Details for d6i4ha2

PDB Entry: 6i4h, 1.4 Å

PDB Description: crystal structure of plasmodium falciparum actin i (f54y mutant) in the ca-atp state

PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d6i4ha2:

Sequence; same for both SEQRES and ATOM records:

>d6i4ha2 c.55.1.1 (A:148-366) automated matches {Plasmodium falciparum [TaxId: 36329]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkeaagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydes

Timeline for d6i4ha2:

• d6i4ha2 is new in SCOPe 2.07-stable
  
• d6i4ha2 appears in the current release, SCOPe 2.08