Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6higl1: 6hig L:2-106 [370180] Other proteins in same PDB: d6higl2 automated match to d1dn0a1 |
PDB Entry: 6hig (more details), 2.2 Å
SCOPe Domain Sequences for d6higl1:
Sequence, based on SEQRES records: (download)
>d6higl1 b.1.1.0 (L:2-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqmtqspssvsasvgdrvtitcsasqgisgdlnwyqqkpgkapklliyhtsslhsgvpsr fsgsgsgtdftltisslqpedfatyycqyyskdlltfgggtklei
>d6higl1 b.1.1.0 (L:2-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqmtqspssvsasvgdrvtitcsasqdlnwyqqkpgkapklliyhtsslhsgvpsrfsgs gsgtdftltisslqpedfatyycqyylltfgggtklei
Timeline for d6higl1: