| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [225582] (23 PDB entries) |
| Domain d6i4ga1: 6i4g A:6-147 [370173] Other proteins in same PDB: d6i4ga2, d6i4gb2, d6i4gg_, d6i4gh_ automated match to d2btfa1 complexed with atp, bme, ca, k, mg, scn |
PDB Entry: 6i4g (more details), 2 Å
SCOPe Domain Sequences for d6i4ga1:
Sequence, based on SEQRES records: (download)
>d6i4ga1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkrgi
ltlkypieqgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimf
esfnvpamyvaiqavlslyssg
>d6i4ga1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpafvgdeaqtkrgiltlkypieqgivt
nwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvpamyvaiq
avlslyssg
Timeline for d6i4ga1:
View in 3DDomains from other chains: (mouse over for more information) d6i4gb1, d6i4gb2, d6i4gg_, d6i4gh_ |