| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (63 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries) |
| Domain d6i4ia1: 6i4i A:6-147 [370169] Other proteins in same PDB: d6i4ia2, d6i4ig_ automated match to d2btfa1 complexed with adp, af3, ca, k, mg, scn; mutant |
PDB Entry: 6i4i (more details), 1.9 Å
SCOPe Domain Sequences for d6i4ia1:
Sequence, based on SEQRES records: (download)
>d6i4ia1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdayvgdeaqtkrgi
ltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimf
esfnvpamyvaiqavlslyssg
>d6i4ia1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpknpdayvgdeaqtkrgiltlkypieh
givtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvpamy
vaiqavlslyssg
Timeline for d6i4ia1: