Lineage for d4hrfb1 (4hrf B:61-211)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483697Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2483698Protein automated matches [190475] (10 species)
    not a true protein
  7. 2483713Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2483738Domain d4hrfb1: 4hrf B:61-211 [370147]
    Other proteins in same PDB: d4hrfa2, d4hrfa3, d4hrfb2, d4hrfb3, d4hrfc2, d4hrfc3
    automated match to d3lj8a_

Details for d4hrfb1

PDB Entry: 4hrf (more details), 1.68 Å

PDB Description: atomic structure of dusp26
PDB Compounds: (B:) Dual specificity protein phosphatase 26

SCOPe Domain Sequences for d4hrfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hrfb1 c.45.1.0 (B:61-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hadevwpglylgdqdmannrrelrrlgithvlnashsrwrgtpeayeglgirylgveahd
spafdmsihfqtaadfihralsqpggkilvhsavgvsrsatlvlaylmlyhhltlveaik
kvkdhrgiipnrgflrqllaldrrlrqglea

SCOPe Domain Coordinates for d4hrfb1:

Click to download the PDB-style file with coordinates for d4hrfb1.
(The format of our PDB-style files is described here.)

Timeline for d4hrfb1: