Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48673] (56 PDB entries) |
Domain d6eg8h_: 6eg8 H: [369965] Other proteins in same PDB: d6eg8a_, d6eg8b1, d6eg8b2, d6eg8d1, d6eg8d2, d6eg8f1, d6eg8f2 automated match to d1gg2g_ complexed with gdp, mg |
PDB Entry: 6eg8 (more details), 2.8 Å
SCOPe Domain Sequences for d6eg8h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eg8h_ a.137.3.1 (H:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} asiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfre
Timeline for d6eg8h_: