Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries) |
Domain d6gt2a1: 6gt2 A:8-166 [369948] Other proteins in same PDB: d6gt2a2 automated match to d5i6la1 complexed with cu, mli |
PDB Entry: 6gt2 (more details), 1.6 Å
SCOPe Domain Sequences for d6gt2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gt2a1 b.6.1.0 (A:8-166) automated matches {Achromobacter cycloclastes [TaxId: 223]} distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d6gt2a1: