Lineage for d6gt2a1 (6gt2 A:8-166)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2381960Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries)
  8. 2381973Domain d6gt2a1: 6gt2 A:8-166 [369948]
    Other proteins in same PDB: d6gt2a2
    automated match to d5i6la1
    complexed with cu, mli

Details for d6gt2a1

PDB Entry: 6gt2 (more details), 1.6 Å

PDB Description: reduced copper nitrite reductase from achromobacter cycloclastes determined by serial femtosecond rotation crystallography
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6gt2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gt2a1 b.6.1.0 (A:8-166) automated matches {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d6gt2a1:

Click to download the PDB-style file with coordinates for d6gt2a1.
(The format of our PDB-style files is described here.)

Timeline for d6gt2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gt2a2