SCOPe 2.07: Domain d6gjsb1: 6gjs B:6-122

Lineage for d6gjsb1 (6gjs B:6-122)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d6gjsb1: 6gjs B:6-122 [369936]
   Other proteins in same PDB: d6gjsa1, d6gjsa2, d6gjsb2, d6gjsc2
   automated match to d4nbzb_
   complexed with atp, mg

Details for d6gjsb1

PDB Entry: 6gjs, 1.95 Å

PDB Description: human nbd1 of cftr in complex with nanobodies d12 and t4

PDB Compounds: (B:) Nanobody D12

SCOPe Domain Sequences for d6gjsb1:

Sequence; same for both SEQRES and ATOM records:

>d6gjsb1 b.1.1.0 (B:6-122) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqagsslrlacaatgsirsinnmgwyrqapgkqrgmvaiitrvgntdyadsvkg
rftisrdnakntvylqmnslkpedtatyychaeiteqsrpfyltddywgqgtqvtvs

Timeline for d6gjsb1:

• d6gjsb1 is new in SCOPe 2.07-stable
  
• d6gjsb1 appears in the current release, SCOPe 2.08