Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (31 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [272416] (3 PDB entries) |
Domain d6fxjd_: 6fxj D: [369883] automated match to d1vdha_ complexed with cl, fec, na, pol |
PDB Entry: 6fxj (more details), 1.79 Å
SCOPe Domain Sequences for d6fxjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fxjd_ d.58.4.0 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]} neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll seqlsklfti
Timeline for d6fxjd_:
View in 3D Domains from other chains: (mouse over for more information) d6fxja_, d6fxjb_, d6fxjc_, d6fxje_ |