Lineage for d6fxjd_ (6fxj D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557030Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2557031Protein automated matches [190081] (31 species)
    not a true protein
  7. 2557176Species Listeria monocytogenes [TaxId:169963] [272416] (3 PDB entries)
  8. 2557185Domain d6fxjd_: 6fxj D: [369883]
    automated match to d1vdha_
    complexed with cl, fec, na, pol

Details for d6fxjd_

PDB Entry: 6fxj (more details), 1.79 Å

PDB Description: structure of coproheme decarboxylase from listeria monocytogenes in complex with iron coproporphyrin iii
PDB Compounds: (D:) Putative heme-dependent peroxidase lmo2113

SCOPe Domain Sequences for d6fxjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxjd_ d.58.4.0 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]}
neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy
silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg
ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy
agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll
seqlsklfti

SCOPe Domain Coordinates for d6fxjd_:

Click to download the PDB-style file with coordinates for d6fxjd_.
(The format of our PDB-style files is described here.)

Timeline for d6fxjd_: