Lineage for d1gbs__ (1gbs -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.5: G-type lysozyme [53987] (1 protein) Protein Lysozyme [53988] (2 species) 
Species Australian black swan (Cygnus atratus) [TaxId:8868] [53990] (2 PDB entries) 
Domain d1gbs__: 1gbs - [36986]
Details for d1gbs__
PDB Entry: 1gbs (more details), 1.8 Å
PDB Description: crystal structure of black swan goose-type lysozyme at 1.8 angstroms resolution
SCOP Domain Sequences for d1gbs__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gbs__ d.2.1.5 (-) Lysozyme {Australian black swan (Cygnus atratus)}
rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
kqhgy
SCOP Domain Coordinates for d1gbs__:
Click to download the PDB-style file with coordinates for d1gbs__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gbs__:
- d1gbs__ appears in SCOP 1.57
- d1gbs__ appears in the current release, SCOPe 2.08, called d1gbsa_
View in 3D