Lineage for d1gbs__ (1gbs -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76885Family d.2.1.5: G-type lysozyme [53987] (1 protein)
  6. 76886Protein Lysozyme [53988] (2 species)
  7. 76887Species Australian black swan (Cygnus atratus) [TaxId:8868] [53990] (2 PDB entries)
  8. 76888Domain d1gbs__: 1gbs - [36986]

Details for d1gbs__

PDB Entry: 1gbs (more details), 1.8 Å

PDB Description: crystal structure of black swan goose-type lysozyme at 1.8 angstroms resolution

SCOP Domain Sequences for d1gbs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbs__ d.2.1.5 (-) Lysozyme {Australian black swan (Cygnus atratus)}
rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
kqhgy

SCOP Domain Coordinates for d1gbs__:

Click to download the PDB-style file with coordinates for d1gbs__.
(The format of our PDB-style files is described here.)

Timeline for d1gbs__: