Lineage for d6fgak_ (6fga K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546525Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2546526Protein automated matches [190120] (9 species)
    not a true protein
  7. 2546531Species Human (Homo sapiens) [TaxId:9606] [186843] (27 PDB entries)
  8. 2546565Domain d6fgak_: 6fga K: [369826]
    automated match to d3fn1b_
    complexed with gol, zn

Details for d6fgak_

PDB Entry: 6fga (more details), 2.82 Å

PDB Description: crystal structure of trim21 e3 ligase, ring domain in complex with its cognate e2 conjugating enzyme ube2e1
PDB Compounds: (K:) Ubiquitin-conjugating enzyme E2 E1

SCOPe Domain Sequences for d6fgak_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fgak_ d.20.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggvfflditf
tpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpa
dplvgsiatqymtnraehdrmarqwtkryat

SCOPe Domain Coordinates for d6fgak_:

Click to download the PDB-style file with coordinates for d6fgak_.
(The format of our PDB-style files is described here.)

Timeline for d6fgak_: