Lineage for d6d6id_ (6d6i D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546113Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (7 PDB entries)
    Uniprot Q13404 80-221! Uniprot Q13404 82-220
  8. 2546120Domain d6d6id_: 6d6i D: [369705]
    Other proteins in same PDB: d6d6ib_, d6d6ic_, d6d6ie_, d6d6if_
    automated match to d2c2vc1

Details for d6d6id_

PDB Entry: 6d6i (more details), 2.55 Å

PDB Description: ube2v1 in complex with ubiquitin variant ubv.v1.1 and ube2n/ubc13
PDB Compounds: (D:) Ubiquitin-conjugating enzyme E2 variant 1

SCOPe Domain Sequences for d6d6id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d6id_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]}
prnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenriyslkiec
gpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlmmsk
enmklpqppegqcysn

SCOPe Domain Coordinates for d6d6id_:

Click to download the PDB-style file with coordinates for d6d6id_.
(The format of our PDB-style files is described here.)

Timeline for d6d6id_: