Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), E2 variant 1 [TaxId:9606] [143051] (7 PDB entries) Uniprot Q13404 80-221! Uniprot Q13404 82-220 |
Domain d6d6id_: 6d6i D: [369705] Other proteins in same PDB: d6d6ib_, d6d6ic_, d6d6ie_, d6d6if_ automated match to d2c2vc1 |
PDB Entry: 6d6i (more details), 2.55 Å
SCOPe Domain Sequences for d6d6id_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d6id_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} prnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtiyenriyslkiec gpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlmmsk enmklpqppegqcysn
Timeline for d6d6id_: