SCOPe 2.07: Domain d6drra_: 6drr A:

Lineage for d6drra_ (6drr A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [357782] (3 PDB entries)

8. Domain d6drra_: 6drr A: [369704]
   automated match to d4gkba_
   complexed with edo

Details for d6drra_

PDB Entry: 6drr, 1.6 Å

PDB Description: crystal structure of cj0485 dehydrogenase

PDB Compounds: (A:) Short-chain dehydrogenase

SCOPe Domain Sequences for d6drra_:

Sequence; same for both SEQRES and ATOM records:

>d6drra_ c.2.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
gqilmpdggyvhldralnw

Timeline for d6drra_:

• d6drra_ is new in SCOPe 2.07-stable
  
• d6drra_ appears in the current release, SCOPe 2.08