Lineage for d5bkec_ (5bke C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2425881Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2425882Protein automated matches [191281] (20 species)
    not a true protein
  7. 2425886Species Bradyrhizobium diazoefficiens [TaxId:224911] [369597] (1 PDB entry)
  8. 2425889Domain d5bkec_: 5bke C: [369598]
    automated match to d5j92a_
    complexed with k, mn, oga

Details for d5bkec_

PDB Entry: 5bke (more details), 2.15 Å

PDB Description: crystal structure of aad-2 in complex with mn(ii) and n-oxalylglycine
PDB Compounds: (C:) Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase

SCOPe Domain Sequences for d5bkec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bkec_ b.82.2.0 (C:) automated matches {Bradyrhizobium diazoefficiens [TaxId: 224911]}
mtiairqlqthfvgqvsgldlrkpltpgearevesamdkyavlvfhdqditdeqqmafal
nfgqredarggtvtkekdyrlqsglndvsnlgkdgkplakdsrthlfnlgnclwhsdssf
rpipakfsllsarvvnptggntefadmraaydalddetkaeiedlvcehslmysrgslgf
teytdeekqmfkpvlqrlvrthpvhrrkslylsshagkiasmsvpegrlllrdlnehatq
pefvyvhkwklhdlvmwdnrqtmhrvrrydqsqprdmrratvagteptv

SCOPe Domain Coordinates for d5bkec_:

Click to download the PDB-style file with coordinates for d5bkec_.
(The format of our PDB-style files is described here.)

Timeline for d5bkec_: