Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (20 species) not a true protein |
Species Bradyrhizobium diazoefficiens [TaxId:224911] [369597] (1 PDB entry) |
Domain d5bkec_: 5bke C: [369598] automated match to d5j92a_ complexed with k, mn, oga |
PDB Entry: 5bke (more details), 2.15 Å
SCOPe Domain Sequences for d5bkec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bkec_ b.82.2.0 (C:) automated matches {Bradyrhizobium diazoefficiens [TaxId: 224911]} mtiairqlqthfvgqvsgldlrkpltpgearevesamdkyavlvfhdqditdeqqmafal nfgqredarggtvtkekdyrlqsglndvsnlgkdgkplakdsrthlfnlgnclwhsdssf rpipakfsllsarvvnptggntefadmraaydalddetkaeiedlvcehslmysrgslgf teytdeekqmfkpvlqrlvrthpvhrrkslylsshagkiasmsvpegrlllrdlnehatq pefvyvhkwklhdlvmwdnrqtmhrvrrydqsqprdmrratvagteptv
Timeline for d5bkec_: