Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (62 PDB entries) |
Domain d6a3eb_: 6a3e B: [369591] Other proteins in same PDB: d6a3ea_ automated match to d5uwsb_ complexed with gtp, mg; mutant |
PDB Entry: 6a3e (more details), 2.7 Å
SCOPe Domain Sequences for d6a3eb_:
Sequence, based on SEQRES records: (download)
>d6a3eb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvr ilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgsken adkfkeefekaqeinkk
>d6a3eb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hfepvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktl kicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefe kaqeinkk
Timeline for d6a3eb_: