SCOPe 2.04: Domain d174lb_: 174l B:

Lineage for d174lb_ (174l B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d174lb_: 174l B: [36957]
   complexed with so4

Details for d174lb_

PDB Entry: 174l, 2.3 Å

PDB Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme

PDB Compounds: (B:) t4 lysozyme

SCOPe Domain Sequences for d174lb_:

Sequence; same for both SEQRES and ATOM records:

>d174lb_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighllaaaadlaaakaalaaaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d174lb_:

• d174lb_ first appeared (with stable ids) in SCOP 1.55
  
• d174lb_ appears in SCOPe 2.03
  
• d174lb_ appears in SCOPe 2.05
  
• d174lb_ appears in the current release, SCOPe 2.08