Lineage for d6a8tb_ (6a8t B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602575Species Enterococcus faecalis [TaxId:565637] [279343] (3 PDB entries)
  8. 2602585Domain d6a8tb_: 6a8t B: [369562]
    automated match to d4wl3a_
    mutant

Details for d6a8tb_

PDB Entry: 6a8t (more details), 2.1 Å

PDB Description: e269a mutant of highly active efbsh
PDB Compounds: (B:) Bile salt hydrolase

SCOPe Domain Sequences for d6a8tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a8tb_ d.153.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 565637]}
ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
esisqffhilssveqqkglcdvgdekyaytiyssccnlekgiyyyrtydnsqitavdmnk
enlekdslivypmvetqqinyan

SCOPe Domain Coordinates for d6a8tb_:

Click to download the PDB-style file with coordinates for d6a8tb_.
(The format of our PDB-style files is described here.)

Timeline for d6a8tb_: