Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (45 species) not a true protein |
Species Eromonas hydrophila [TaxId:380703] [369350] (1 PDB entry) |
Domain d6k2qb1: 6k2q B:1-230 [369355] Other proteins in same PDB: d6k2qa2, d6k2qb2, d6k2qc2, d6k2qd2 automated match to d4f3ka_ complexed with ade |
PDB Entry: 6k2q (more details), 2 Å
SCOPe Domain Sequences for d6k2qb1:
Sequence, based on SEQRES records: (download)
>d6k2qb1 c.56.2.0 (B:1-230) automated matches {Eromonas hydrophila [TaxId: 380703]} mkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkvaasvats lllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaqqpaafp cdetliavaqdciaeqgkhqtkvglictgdqfmckpdaiakaradfpqmlavemegaaig qvchmfkvpylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl
>d6k2qb1 c.56.2.0 (B:1-230) automated matches {Eromonas hydrophila [TaxId: 380703]} mkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkvaasvats lllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaqqpaafp cdetliavaqdckvglictgdqfmckpdaiakaradfpqmlavemegaaigqvchmfkvp ylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl
Timeline for d6k2qb1: