SCOPe 2.07: Domain d6k2qb1: 6k2q B:1-230

Lineage for d6k2qb1 (6k2q B:1-230)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (45 species)
   not a true protein

7. Species Eromonas hydrophila [TaxId:380703] [369350] (1 PDB entry)

8. Domain d6k2qb1: 6k2q B:1-230 [369355]
   Other proteins in same PDB: d6k2qa2, d6k2qb2, d6k2qc2, d6k2qd2
   automated match to d4f3ka_
   complexed with ade

Details for d6k2qb1

PDB Entry: 6k2q, 2 Å

PDB Description: aeromonas hydrophila mtan-2 complexed with adenine

PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d6k2qb1:

Sequence, based on SEQRES records:

>d6k2qb1 c.56.2.0 (B:1-230) automated matches {Eromonas hydrophila [TaxId: 380703]}
mkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkvaasvats
lllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaqqpaafp
cdetliavaqdciaeqgkhqtkvglictgdqfmckpdaiakaradfpqmlavemegaaig
qvchmfkvpylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl

Sequence, based on observed residues (ATOM records):

>d6k2qb1 c.56.2.0 (B:1-230) automated matches {Eromonas hydrophila [TaxId: 380703]}
mkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkvaasvats
lllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaqqpaafp
cdetliavaqdckvglictgdqfmckpdaiakaradfpqmlavemegaaigqvchmfkvp
ylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl

Timeline for d6k2qb1:

• d6k2qb1 is new in SCOPe 2.07-stable
  
• d6k2qb1 appears in the current release, SCOPe 2.08