SCOPe 2.07: Domain d6owmb2: 6owm B:164-339

Lineage for d6owmb2 (6owm B:164-339)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (52 PDB entries)
   Uniprot P00327

8. Domain d6owmb2: 6owm B:164-339 [369223]
   Other proteins in same PDB: d6owma1, d6owmb1
   automated match to d1axea2
   complexed with mrd, naj, pfb, zn

Details for d6owmb2

PDB Entry: 6owm, 1.1 Å

PDB Description: horse liver f93w alcohol dehydrogenase complexed with nad and pentafluorobenzyl alcohol

PDB Compounds: (B:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d6owmb2:

Sequence; same for both SEQRES and ATOM records:

>d6owmb2 c.2.1.1 (B:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

Timeline for d6owmb2:

• d6owmb2 is new in SCOPe 2.07-stable
  
• d6owmb2 appears in the current release, SCOPe 2.08