SCOPe 2.07: Domain d6o0oc_: 6o0o C:

Lineage for d6o0oc_ (6o0o C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 [64524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64525] (18 PDB entries)

8. Domain d6o0oc_: 6o0o C: [369169]
   automated match to d2o22a_
   complexed with f3q; mutant

Details for d6o0oc_

PDB Entry: 6o0o, 2 Å

PDB Description: crystal structure of bcl-2 g101v mutation with s55746

PDB Compounds: (C:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d6o0oc_:

Sequence, based on SEQRES records:

>d6o0oc_ f.1.4.1 (C:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
dnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqavddfsrryrr
dfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplv
dnialwmteylnrhlhtwiqdnggwdafvelyg

Sequence, based on observed residues (ATOM records):

>d6o0oc_ f.1.4.1 (C:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
dnreivmkyihyklsqrgyewdaevvhltlrqavddfsrryrrdfaemssqlhltpftar
grfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteylnrhlht
wiqdnggwdafvelyg

Timeline for d6o0oc_:

• d6o0oc_ is new in SCOPe 2.07-stable
  
• d6o0oc_ appears in the current release, SCOPe 2.08