SCOPe 2.07: Domain d6nqib_: 6nqi B:

Lineage for d6nqib_ (6nqi B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Cyanidioschyzon merolae [TaxId:280699] [369149] (1 PDB entry)

8. Domain d6nqib_: 6nqi B: [369150]
   automated match to d4jkbb_
   complexed with bme

Details for d6nqib_

PDB Entry: 6nqi, 2.75 Å

PDB Description: prp8 rh domain from c. merolae

PDB Compounds: (B:) Pre-mRNA splicing factor PRP8

SCOPe Domain Sequences for d6nqib_:

Sequence, based on SEQRES records:

>d6nqib_ c.55.3.0 (B:) automated matches {Cyanidioschyzon merolae [TaxId: 280699]}
lwrqrlwivddrtayrphangviwiwetstgrlfvkivhrttwagqtrraqlakwkcaeh
vltmlrsqpteelprgivlaqtasmdplktllagteyakipvragaaamplqalmalpei
rdrtqtarsselsiwsgyadwlehvpvwiasarfllllhaldrapervlqlvwpqrsade
esagsatpwlwpalpetdwrrlelel

Sequence, based on observed residues (ATOM records):

>d6nqib_ c.55.3.0 (B:) automated matches {Cyanidioschyzon merolae [TaxId: 280699]}
lwrqrlwivddrtayrphangviwiwetstgrlfvkivhrttwagaqlakwkcaehvltm
lrsqpteelprgivlaqtasmdplktllagteyakipvragaaamplqalmalpeirdrt
qtarsselsiwsgyadwlehvpvwiasarfllllhaldrapervlqlvwwlwpalpetdw
rrlelel

Timeline for d6nqib_:

• d6nqib_ is new in SCOPe 2.07-stable
  
• d6nqib_ appears in the current release, SCOPe 2.08