Class b: All beta proteins [48724] (178 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
Protein automated matches [190564] (3 species) not a true protein |
Species Gallus gallus [TaxId:9031] [369124] (1 PDB entry) |
Domain d6iejb1: 6iej B:16-140 [369145] Other proteins in same PDB: d6ieja2, d6iejb2, d6iejc2 automated match to d1rlwa_ complexed with ca, hxg, mg |
PDB Entry: 6iej (more details), 2.21 Å
SCOPe Domain Sequences for d6iejb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iejb1 b.7.1.1 (B:16-140) automated matches {Gallus gallus [TaxId: 9031]} yshvftvtvrkatnvtkgaigdmldtpdpyvelfipsapdcrkrtkhfnndvnpvwnetf efildpnqdnvlevtlmdanyvmdetlgmatfpisslklgekkevqltfnnvtemtlels levcs
Timeline for d6iejb1:
View in 3D Domains from other chains: (mouse over for more information) d6ieja1, d6ieja2, d6iejc1, d6iejc2 |