Lineage for d6gwkj_ (6gwk J:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397050Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2397051Protein automated matches [190914] (14 species)
    not a true protein
  7. 2397131Species Caulobacter vibrioides [TaxId:190650] [369058] (1 PDB entry)
  8. 2397141Domain d6gwkj_: 6gwk J: [369085]
    automated match to d3inzf_

Details for d6gwkj_

PDB Entry: 6gwk (more details), 2.15 Å

PDB Description: the crystal structure of hfq from caulobacter crescentus
PDB Compounds: (J:) RNA-binding protein Hfq

SCOPe Domain Sequences for d6gwkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwkj_ b.38.1.0 (J:) automated matches {Caulobacter vibrioides [TaxId: 190650]}
kqnlqdtflnsvrksktpltiflvngvklqgvvswfdnfcvllrrdgqsqlvykhaisti
mpaqpvqlyepsadadd

SCOPe Domain Coordinates for d6gwkj_:

Click to download the PDB-style file with coordinates for d6gwkj_.
(The format of our PDB-style files is described here.)

Timeline for d6gwkj_: