Lineage for d6goya1 (6goy A:1-218)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2548078Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries)
  8. 2548107Domain d6goya1: 6goy A:1-218 [369055]
    Other proteins in same PDB: d6goya2
    automated match to d2dddb_
    complexed with cr8, edo, gol, peg

Details for d6goya1

PDB Entry: 6goy (more details), 1.65 Å

PDB Description: structure of meos4b in the green fluorescent state
PDB Compounds: (A:) Green to red photoconvertible GFP-like protein EosFP

SCOPe Domain Sequences for d6goya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6goya1 d.22.1.0 (A:1-218) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmriklrmegnvnghhfvidgdgtgkpyegkqtmdlevkeggplpfafdiltta
fhygnrvfvkypdniqdyfkqsfpkgyswersltfedggicnarnditmegdtfynkvrf
ygtnfpangpvmqkktlkwepstekmyvrdgvltgdiemalllegnahyrcdfrttykak
ekgvklpgahfvdhaieilshdkdynkvklyehavahs

SCOPe Domain Coordinates for d6goya1:

Click to download the PDB-style file with coordinates for d6goya1.
(The format of our PDB-style files is described here.)

Timeline for d6goya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6goya2