Lineage for d6fxwa_ (6fxw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529227Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2529228Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2529280Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2529281Protein automated matches [191196] (11 species)
    not a true protein
  7. 2529320Species Leishmania infantum [TaxId:5671] [369049] (1 PDB entry)
  8. 2529321Domain d6fxwa_: 6fxw A: [369050]
    automated match to d3sdwa_
    complexed with so4

Details for d6fxwa_

PDB Entry: 6fxw (more details), 1.57 Å

PDB Description: structure of leishmania infantum type b ribose 5-phosphate isomerase
PDB Compounds: (A:) Putative ribose 5-phosphate isomerase

SCOPe Domain Sequences for d6fxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fxwa_ c.121.1.0 (A:) automated matches {Leishmania infantum [TaxId: 5671]}
mpkrvalgcdhaayathqeimdmvnasgaaskvmymgpssdtsvdypdyaaqvceailkg
eadtgilvcgtgigmsiaankfrgiraalcydhvtaqlsrqhnnahilcigvrtsgmevi
rdiietfltteplaegrhgnrvdkitvieeeqm

SCOPe Domain Coordinates for d6fxwa_:

Click to download the PDB-style file with coordinates for d6fxwa_.
(The format of our PDB-style files is described here.)

Timeline for d6fxwa_: