Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) |
Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
Protein automated matches [191196] (11 species) not a true protein |
Species Leishmania infantum [TaxId:5671] [369049] (1 PDB entry) |
Domain d6fxwa_: 6fxw A: [369050] automated match to d3sdwa_ complexed with so4 |
PDB Entry: 6fxw (more details), 1.57 Å
SCOPe Domain Sequences for d6fxwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fxwa_ c.121.1.0 (A:) automated matches {Leishmania infantum [TaxId: 5671]} mpkrvalgcdhaayathqeimdmvnasgaaskvmymgpssdtsvdypdyaaqvceailkg eadtgilvcgtgigmsiaankfrgiraalcydhvtaqlsrqhnnahilcigvrtsgmevi rdiietfltteplaegrhgnrvdkitvieeeqm
Timeline for d6fxwa_: