Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins) |
Protein Phage T4 lysozyme [53982] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53983] (371 PDB entries) many mutant structures |
Domain d152l__: 152l - [36904] complexed with so4; mutant |
PDB Entry: 152l (more details), 2 Å
SCOP Domain Sequences for d152l__:
Sequence; same for both SEQRES and ATOM records: (download)
>d152l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4} mncfemlrcdeglrlkiykdcegyytigighlltkspslnaakseldkaigrntngvitk deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm lqqkrwdeaavnlaksrwynqcpnrakrvittfrtgtwdayknc
Timeline for d152l__: