Lineage for d6mxuc1 (6mxu C:8-324)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385277Species Influenza a virus (a/texas/1/1977(h3n2)) [TaxId:444318] [368880] (1 PDB entry)
  8. 2385280Domain d6mxuc1: 6mxu C:8-324 [369005]
    Other proteins in same PDB: d6mxua2, d6mxub2, d6mxuc2
    automated match to d5k9kf1
    complexed with bma, nag

Details for d6mxuc1

PDB Entry: 6mxu (more details), 1.85 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/texas/1/1977 (h3n2)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6mxuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mxuc1 b.19.1.2 (C:8-324) Hemagglutinin {Influenza a virus (a/texas/1/1977(h3n2)) [TaxId: 444318]}
nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli
dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw
tgvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpst
dkeqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillins
ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk
yvkqntlklatgmrnvp

SCOPe Domain Coordinates for d6mxuc1:

Click to download the PDB-style file with coordinates for d6mxuc1.
(The format of our PDB-style files is described here.)

Timeline for d6mxuc1: