Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (19 species) includes rudiment esterase domain |
Species Influenza a virus (a/texas/1/1977(h3n2)) [TaxId:444318] [368880] (1 PDB entry) |
Domain d6mxuc1: 6mxu C:8-324 [369005] Other proteins in same PDB: d6mxua2, d6mxub2, d6mxuc2 automated match to d5k9kf1 complexed with bma, nag |
PDB Entry: 6mxu (more details), 1.85 Å
SCOPe Domain Sequences for d6mxuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mxuc1 b.19.1.2 (C:8-324) Hemagglutinin {Influenza a virus (a/texas/1/1977(h3n2)) [TaxId: 444318]} nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctli dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnw tgvtqnggsyackrgpdnsffsrlnwlyksestypvlnvtmpnndnfdklyiwgvhhpst dkeqtnlyvqasgrvtvstkrsqqtiipnvgsrpwvrglssgisiywtivkpgdillins ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk yvkqntlklatgmrnvp
Timeline for d6mxuc1:
View in 3D Domains from other chains: (mouse over for more information) d6mxua1, d6mxua2, d6mxub1, d6mxub2 |