Lineage for d6q9ya_ (6q9y A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325522Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2325523Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2325707Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 2325708Protein automated matches [190960] (1 species)
    not a true protein
  7. 2325709Species Human (Homo sapiens) [TaxId:9606] [188578] (22 PDB entries)
  8. 2325711Domain d6q9ya_: 6q9y A: [368952]
    automated match to d5trfd_
    complexed with hrq

Details for d6q9ya_

PDB Entry: 6q9y (more details), 1.2 Å

PDB Description: hdmx (14-111; c17s) complexed with compound 16 at 1.20a; structural states of hdm2 and hdmx: x-ray elucidation of adaptations and binding interactions for different chemical compound classes
PDB Compounds: (A:) Protein Mdm4

SCOPe Domain Sequences for d6q9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q9ya_ a.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell
grqsfsvkdpsplydmlrknlvtla

SCOPe Domain Coordinates for d6q9ya_:

Click to download the PDB-style file with coordinates for d6q9ya_.
(The format of our PDB-style files is described here.)

Timeline for d6q9ya_: