SCOPe 2.07: Domain d6omly_: 6oml Y:

Lineage for d6omly_ (6oml Y:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57517] (16 PDB entries)

8. Domain d6omly_: 6oml Y: [368934]
   automated match to d3bmpa_
   complexed with bma, man, nag

Details for d6omly_

PDB Entry: 6oml, 2.7 Å

PDB Description: human bmp chimera bv261

PDB Compounds: (Y:) Bone morphogenetic protein 2 and Bone morphogenetic protein 6

SCOPe Domain Sequences for d6omly_:

Sequence; same for both SEQRES and ATOM records:

>d6omly_ g.17.1.2 (Y:) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]}
kssckrhplyvdfsdvgwndwivappgyhafycdgecsfplnahmnatnhaivqtlvhlm
npeyvpkpccaptelsaismlyldenekvvlknyqdmvvegcgcr

Timeline for d6omly_:

• d6omly_ is new in SCOPe 2.07-stable
  
• d6omly_ appears in the current release, SCOPe 2.08